PDB entry 1d1v

View 1d1v on RCSB PDB site
Description: bovine endothelial nitric oxide synthase heme domain complexed with s-ethyl-n-phenyl-isothiourea (h4b bound)
Deposited on 1999-09-21, released 2001-07-25
The last revision prior to the SCOP 1.57 freeze date was dated 2001-07-25, with a file datestamp of 2001-07-25.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.186
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1d1va_
  • Chain 'B':
    Domains in SCOP 1.57: d1d1vb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1vA (A:)
    gpkfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqll
    sqardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprc
    vgriqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriw
    nsqlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfv
    lppelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigt
    rnlcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaat
    vsfmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1vB (B:)
    kfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqllsq
    ardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprcvg
    riqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriwns
    qlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfvlp
    pelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigtrn
    lcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaatvs
    fmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw