PDB entry 1d1u

View 1d1u on RCSB PDB site
Description: use of an n-terminal fragment from moloney murine leukemia virus reverse transcriptase to facilitate crystallization and analysis of a pseudo-16-mer DNA molecule containing g-a mispairs
Class: hydrolase/DNA
Keywords: g-a mispair, syn-adenine, nucleic acid, protein-DNA complex, single-strand overhang, reverse transcriptase, crystal structure, moloney murine leukemia virus, hydrolase/DNA complex
Deposited on 1999-09-21, released 2000-04-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.23
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (reverse transcriptase)
    Species: Murine leukemia virus [TaxId:11801]
    Gene: MMLV REVERSE TRANSCRIPTASE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d1ua_
  • Chain 'B':
    Compound: DNA (5'-d(*cp*tp*cp*gp*tp*g)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*ap*cp*gp*gp*cp*ap*cp*gp*ap*g)-3')
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1uA (A:)
    twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
    qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
    qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
    hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
    kqvkylgyllkegqr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.