PDB entry 1d1t

View 1d1t on RCSB PDB site
Description: mutant of human sigma alcohol dehydrogenase with leucine at position 141
Deposited on 1999-09-21, released 1999-09-23
The last revision prior to the SCOP 1.61 freeze date was dated 2000-01-07, with a file datestamp of 2000-01-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.216
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1tA (A:)
    gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
    fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
    vladgttrftckgkpvhhflntstfteytvvdessvakiddaappekvcligcgfstgyg
    aavktgkvkpgstcvvfglggvglsvimgcksagasriigidlnkdkfekamavgateci
    spkdstkpisevlsemtgnnvgytfevighletmidalaschmnygtsvvvgvppsakml
    tydpmllftgrtwkgcvfgglksrddvpklvteflakkfdldqlithvlpfkkisegfel
    lnsgqsirtvltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1tB (B:)
    gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
    fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
    vladgttrftckgkpvhhflntstfteytvvdessvakiddaappekvcligcgfstgyg
    aavktgkvkpgstcvvfglggvglsvimgcksagasriigidlnkdkfekamavgateci
    spkdstkpisevlsemtgnnvgytfevighletmidalaschmnygtsvvvgvppsakml
    tydpmllftgrtwkgcvfgglksrddvpklvteflakkfdldqlithvlpfkkisegfel
    lnsgqsirtvltf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1tC (C:)
    gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
    fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
    vladgttrftckgkpvhhflntstfteytvvdessvakiddaappekvcligcgfstgyg
    aavktgkvkpgstcvvfglggvglsvimgcksagasriigidlnkdkfekamavgateci
    spkdstkpisevlsemtgnnvgytfevighletmidalaschmnygtsvvvgvppsakml
    tydpmllftgrtwkgcvfgglksrddvpklvteflakkfdldqlithvlpfkkisegfel
    lnsgqsirtvltf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1tD (D:)
    gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
    fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
    vladgttrftckgkpvhhflntstfteytvvdessvakiddaappekvcligcgfstgyg
    aavktgkvkpgstcvvfglggvglsvimgcksagasriigidlnkdkfekamavgateci
    spkdstkpisevlsemtgnnvgytfevighletmidalaschmnygtsvvvgvppsakml
    tydpmllftgrtwkgcvfgglksrddvpklvteflakkfdldqlithvlpfkkisegfel
    lnsgqsirtvltf