PDB entry 1d1s

View 1d1s on RCSB PDB site
Description: wild-type human sigma (class iv) alcohol dehydrogenase
Deposited on 1999-09-21, released 1999-09-23
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-07, with a file datestamp of 2000-01-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1sA (A:)
    gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
    fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
    vladgttrftckgkpvhhfmntstfteytvvdessvakiddaappekvcligcgfstgyg
    aavktgkvkpgstcvvfglggvglsvimgcksagasriigidlnkdkfekamavgateci
    spkdstkpisevlsemtgnnvgytfevighletmidalaschmnygtsvvvgvppsakml
    tydpmllftgrtwkgcvfgglksrddvpklvteflakkfdldqlithvlpfkkisegfel
    lnsgqsirtvltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1sB (B:)
    gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
    fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
    vladgttrftckgkpvhhfmntstfteytvvdessvakiddaappekvcligcgfstgyg
    aavktgkvkpgstcvvfglggvglsvimgcksagasriigidlnkdkfekamavgateci
    spkdstkpisevlsemtgnnvgytfevighletmidalaschmnygtsvvvgvppsakml
    tydpmllftgrtwkgcvfgglksrddvpklvteflakkfdldqlithvlpfkkisegfel
    lnsgqsirtvltf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1sC (C:)
    gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
    fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
    vladgttrftckgkpvhhfmntstfteytvvdessvakiddaappekvcligcgfstgyg
    aavktgkvkpgstcvvfglggvglsvimgcksagasriigidlnkdkfekamavgateci
    spkdstkpisevlsemtgnnvgytfevighletmidalaschmnygtsvvvgvppsakml
    tydpmllftgrtwkgcvfgglksrddvpklvteflakkfdldqlithvlpfkkisegfel
    lnsgqsirtvltf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1sD (D:)
    gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
    fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
    vladgttrftckgkpvhhfmntstfteytvvdessvakiddaappekvcligcgfstgyg
    aavktgkvkpgstcvvfglggvglsvimgcksagasriigidlnkdkfekamavgateci
    spkdstkpisevlsemtgnnvgytfevighletmidalaschmnygtsvvvgvppsakml
    tydpmllftgrtwkgcvfgglksrddvpklvteflakkfdldqlithvlpfkkisegfel
    lnsgqsirtvltf