PDB entry 1d1s

View 1d1s on RCSB PDB site
Description: wild-type human sigma (class IV) alcohol dehydrogenase
Class: oxidoreductase
Keywords: rossman or dinucleotide fold, oxidoreductase
Deposited on 1999-09-21, released 1999-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase class IV sigma chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d1sa1, d1d1sa2
  • Chain 'B':
    Compound: alcohol dehydrogenase class IV sigma chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d1sb1, d1d1sb2
  • Chain 'C':
    Compound: alcohol dehydrogenase class IV sigma chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d1sc1, d1d1sc2
  • Chain 'D':
    Compound: alcohol dehydrogenase class IV sigma chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d1sd1, d1d1sd2
  • Heterogens: ZN, ACT, CAC, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1sA (A:)
    gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
    fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
    vladgttrftckgkpvhhfmntstfteytvvdessvakiddaappekvcligcgfstgyg
    aavktgkvkpgstcvvfglggvglsvimgcksagasriigidlnkdkfekamavgateci
    spkdstkpisevlsemtgnnvgytfevighletmidalaschmnygtsvvvgvppsakml
    tydpmllftgrtwkgcvfgglksrddvpklvteflakkfdldqlithvlpfkkisegfel
    lnsgqsirtvltf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1sB (B:)
    gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
    fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
    vladgttrftckgkpvhhfmntstfteytvvdessvakiddaappekvcligcgfstgyg
    aavktgkvkpgstcvvfglggvglsvimgcksagasriigidlnkdkfekamavgateci
    spkdstkpisevlsemtgnnvgytfevighletmidalaschmnygtsvvvgvppsakml
    tydpmllftgrtwkgcvfgglksrddvpklvteflakkfdldqlithvlpfkkisegfel
    lnsgqsirtvltf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1sC (C:)
    gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
    fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
    vladgttrftckgkpvhhfmntstfteytvvdessvakiddaappekvcligcgfstgyg
    aavktgkvkpgstcvvfglggvglsvimgcksagasriigidlnkdkfekamavgateci
    spkdstkpisevlsemtgnnvgytfevighletmidalaschmnygtsvvvgvppsakml
    tydpmllftgrtwkgcvfgglksrddvpklvteflakkfdldqlithvlpfkkisegfel
    lnsgqsirtvltf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1sD (D:)
    gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
    fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
    vladgttrftckgkpvhhfmntstfteytvvdessvakiddaappekvcligcgfstgyg
    aavktgkvkpgstcvvfglggvglsvimgcksagasriigidlnkdkfekamavgateci
    spkdstkpisevlsemtgnnvgytfevighletmidalaschmnygtsvvvgvppsakml
    tydpmllftgrtwkgcvfgglksrddvpklvteflakkfdldqlithvlpfkkisegfel
    lnsgqsirtvltf