PDB entry 1d1r

View 1d1r on RCSB PDB site
Description: nmr solution structure of the product of the e. coli ycih gene.
Class: structural genomics
Keywords: alpha-beta plait, open-faced beta sandwich, ferredoxin-like fold, structural genomics
Deposited on 1999-09-20, released 1999-10-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical 11.4 kd protein ycih in pyrf-osmb intergenic region
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08245 (Start-107)
      • c-terminal his tag (108-109)
    Domains in SCOPe 2.07: d1d1ra1, d1d1ra2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d1rA (A:)
    msdsnsrlvystetgridepkaapvrpkgdgvvriqrqtsgrkgkgvclitgvdlddael
    tklaaelkkkcgcggavkdgvieiqgdkrdllkslleakgmkvklagglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d1rA (A:)
    kgdgvvriqrqtsgrkgkgvclitgvdlddaeltklaaelkkkcgcggavkdgvieiqgd
    krdllkslleakgmkvklaggle