PDB entry 1d1q

View 1d1q on RCSB PDB site
Description: crystal structure of a yeast low molecular weight protein tyrosine phosphatase (ltp1) complexed with the substrate pnpp
Deposited on 1999-09-20, released 2000-03-08
The last revision prior to the SCOP 1.57 freeze date was dated 2000-03-08, with a file datestamp of 2000-03-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.17
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1d1qa_
  • Chain 'B':
    Domains in SCOP 1.57: d1d1qb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1qA (A:)
    iekpkisvafialgnfcrspmaeaifkhevekanlenrfnkidsfgtsnyhvgespdhrt
    vsickqhgvkinhkgkqiktkhfdeydyiigmdesninnlkkiqpegskakvclfgdwnt
    ndgtvqtiiedpwygdiqdfeynfkqityfskqflkkel
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1qB (B:)
    ekpkisvafialgnfcrspmaeaifkhevekanlenrfnkidsfgtsnyhvgespdhrtv
    sickqhgvkinhkgkqiktkhfdeydyiigmdesninnlkkiqpegskakvclfgdwntn
    dgtvqtiiedpwygdiqdfeynfkqityfskqflkkel