PDB entry 1d1q

View 1d1q on RCSB PDB site
Description: crystal structure of a yeast low molecular weight protein tyrosine phosphatase (ltp1) complexed with the substrate pnpp
Class: hydrolase
Keywords: beta-alpha-beta, hydrolase
Deposited on 1999-09-20, released 2000-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.17
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine phosphatase (e.c.3.1.3.48)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40347 (Start-160)
      • engineered (13)
    Domains in SCOPe 2.07: d1d1qa_
  • Chain 'B':
    Compound: tyrosine phosphatase (e.c.3.1.3.48)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40347 (Start-160)
      • engineered (13)
    Domains in SCOPe 2.07: d1d1qb_
  • Heterogens: PO4, 4NP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d1qA (A:)
    mtiekpkisvafialgnfcrspmaeaifkhevekanlenrfnkidsfgtsnyhvgespdh
    rtvsickqhgvkinhkgkqiktkhfdeydyiigmdesninnlkkiqpegskakvclfgdw
    ntndgtvqtiiedpwygdiqdfeynfkqityfskqflkkel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d1qA (A:)
    iekpkisvafialgnfcrspmaeaifkhevekanlenrfnkidsfgtsnyhvgespdhrt
    vsickqhgvkinhkgkqiktkhfdeydyiigmdesninnlkkiqpegskakvclfgdwnt
    ndgtvqtiiedpwygdiqdfeynfkqityfskqflkkel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d1qB (B:)
    mtiekpkisvafialgnfcrspmaeaifkhevekanlenrfnkidsfgtsnyhvgespdh
    rtvsickqhgvkinhkgkqiktkhfdeydyiigmdesninnlkkiqpegskakvclfgdw
    ntndgtvqtiiedpwygdiqdfeynfkqityfskqflkkel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d1qB (B:)
    ekpkisvafialgnfcrspmaeaifkhevekanlenrfnkidsfgtsnyhvgespdhrtv
    sickqhgvkinhkgkqiktkhfdeydyiigmdesninnlkkiqpegskakvclfgdwntn
    dgtvqtiiedpwygdiqdfeynfkqityfskqflkkel