PDB entry 1d1p

View 1d1p on RCSB PDB site
Description: crystal structure of a yeast low molecular weight protein tyrosine phosphatase (ltp1)
Deposited on 1999-09-20, released 2000-03-08
The last revision prior to the SCOP 1.57 freeze date was dated 2000-03-08, with a file datestamp of 2000-03-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.169
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1d1pa_
  • Chain 'B':
    Domains in SCOP 1.57: d1d1pb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1pA (A:)
    pkisvaficlgnfcrspmaeaifkhevekanlenrfnkidsfgtsnyhvgespdhrtvsi
    ckqhgvkinhkgkqiktkhfdeydyiigmdesninnlkkiqpegskakvclfgdwntndg
    tvqtiiedpwygdiqdfeynfkqityfskqflkkel
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1pB (B:)
    kpkisvaficlgnfcrspmaeaifkhevekanlenrfnkidsfgtsnyhvgespdhrtvs
    ickqhgvkinhkgkqiktkhfdeydyiigmdesninnlkkiqpegskakvclfgdwntnd
    gtvqtiiedpwygdiqdfeynfkqityfskqflkkel