PDB entry 1d1o

View 1d1o on RCSB PDB site
Description: cooperativity in ef-hand ca2+-binding proteins: evidence of site-site communication from binding-induced changes in structure and dynamics of n56a calbindin d9k
Class: signaling protein
Keywords: ef-hand, calcium-binding protein, nmr, signal transduction, signaling protein
Deposited on 1999-09-20, released 2000-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calbindin d9k
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02633 (0-74)
      • conflict (42)
      • conflict (55)
    Domains in SCOPe 2.08: d1d1oa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1oA (A:)
    kspeelkgifekyaakegdpnqlskeelklllqtefpsllkgmstldelfeeldkagdge
    vsfeefqvlvkkisq