PDB entry 1d1l

View 1d1l on RCSB PDB site
Description: crystal structure of cro-f58w mutant
Class: Viral protein
Keywords: HELIX-TURN-HELIX, Viral protein
Deposited on 1999-09-17, released 1999-10-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.181
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lambda cro repressor
    Species: Enterobacteria phage lambda [TaxId:10710]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03040 (0-60)
      • mutation (57)
    Domains in SCOPe 2.06: d1d1la_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1lA (A:)
    meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpwps
    n