PDB entry 1d1l

View 1d1l on RCSB PDB site
Description: crystal structure of cro-f58w mutant
Deposited on 1999-09-17, released 1999-10-01
The last revision prior to the SCOP 1.69 freeze date was dated 2000-03-15, with a file datestamp of 2000-03-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1d1la_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1lA (A:)
    meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpwps
    n