PDB entry 1d1l

View 1d1l on RCSB PDB site
Description: crystal structure of cro-f58w mutant
Class: viral protein
Keywords: HELIX-TURN-HELIX, Viral protein
Deposited on 1999-09-17, released 1999-10-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lambda cro repressor
  Species: Enterobacteria phage lambda [TaxId:10710]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03040 (0-60)
    • engineered mutation (57)
  Domains in SCOPe 2.08: d1d1la_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d1lA (A:)
  meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpwps
  n