PDB entry 1d1k

View 1d1k on RCSB PDB site
Description: mutated shiga-like toxin b subunit (d17e/w34a) complexed with receptor gb3 analogue
Class: toxin
Keywords: toxin, receptor binding, protein-carbohydrate recognition, ob-fold
Deposited on 1999-09-17, released 2000-09-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-07-18, with a file datestamp of 2012-07-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.193
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: shiga-like toxin I subunit b
  Species: Phage h30 [TaxId:12371]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08027
    • mutation (16)
    • mutation (33)
  Domains in SCOPe 2.06: d1d1ka_
• Chain 'B':
  Compound: shiga-like toxin I subunit b
  Species: Phage h30 [TaxId:12371]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08027
    • mutation (16)
    • mutation (33)
  Domains in SCOPe 2.06: d1d1kb_
• Chain 'C':
  Compound: shiga-like toxin I subunit b
  Species: Phage h30 [TaxId:12371]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08027
    • mutation (16)
    • mutation (33)
  Domains in SCOPe 2.06: d1d1kc_
• Chain 'D':
  Compound: shiga-like toxin I subunit b
  Species: Phage h30 [TaxId:12371]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08027
    • mutation (16)
    • mutation (33)
  Domains in SCOPe 2.06: d1d1kd_
• Chain 'E':
  Compound: shiga-like toxin I subunit b
  Species: Phage h30 [TaxId:12371]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08027 (0-68)
    • mutation (16)
    • mutation (33)
  Domains in SCOPe 2.06: d1d1ke_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d1kA (A:)
  tpdcvtgkveytkyndedtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
  ggfsevifr
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d1kB (B:)
  tpdcvtgkveytkyndedtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
  ggfsevifr
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d1kC (C:)
  tpdcvtgkveytkyndedtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
  ggfsevifr
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d1kD (D:)
  tpdcvtgkveytkyndedtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
  ggfsevifr
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d1kE (E:)
  tpdcvtgkveytkyndedtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
  ggfsevifr