PDB entry 1d1k

View 1d1k on RCSB PDB site
Description: mutated shiga-like toxin b subunit (d17e/w34a) complexed with receptor gb3 analogue
Class: toxin
Keywords: toxin, receptor binding, protein-carbohydrate recognition, ob-fold
Deposited on 1999-09-17, released 2000-09-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: shiga-like toxin I subunit b
    Species: Phage h30 [TaxId:12371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08027
      • engineered mutation (16)
      • engineered mutation (33)
    Domains in SCOPe 2.08: d1d1ka_
  • Chain 'B':
    Compound: shiga-like toxin I subunit b
    Species: Phage h30 [TaxId:12371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08027
      • engineered mutation (16)
      • engineered mutation (33)
    Domains in SCOPe 2.08: d1d1kb_
  • Chain 'C':
    Compound: shiga-like toxin I subunit b
    Species: Phage h30 [TaxId:12371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08027
      • engineered mutation (16)
      • engineered mutation (33)
    Domains in SCOPe 2.08: d1d1kc_
  • Chain 'D':
    Compound: shiga-like toxin I subunit b
    Species: Phage h30 [TaxId:12371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08027
      • engineered mutation (16)
      • engineered mutation (33)
    Domains in SCOPe 2.08: d1d1kd_
  • Chain 'E':
    Compound: shiga-like toxin I subunit b
    Species: Phage h30 [TaxId:12371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08027 (0-68)
      • engineered mutation (16)
      • engineered mutation (33)
    Domains in SCOPe 2.08: d1d1ke_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1kA (A:)
    tpdcvtgkveytkyndedtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1kB (B:)
    tpdcvtgkveytkyndedtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1kC (C:)
    tpdcvtgkveytkyndedtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1kD (D:)
    tpdcvtgkveytkyndedtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1kE (E:)
    tpdcvtgkveytkyndedtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
    ggfsevifr