PDB entry 1d1k
View 1d1k on RCSB PDB site
Description: mutated shiga-like toxin b subunit (d17e/w34a) complexed with receptor gb3 analogue
Class: toxin
Keywords: toxin, receptor binding, protein-carbohydrate recognition, ob-fold
Deposited on
1999-09-17, released
2000-09-20
The last revision prior to the SCOPe 2.08 freeze date was dated
2020-07-29, with a file datestamp of
2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.39
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: shiga-like toxin I subunit b
Species: Phage h30 [TaxId:12371]
Database cross-references and differences (RAF-indexed):
- Uniprot P08027
- engineered mutation (16)
- engineered mutation (33)
Domains in SCOPe 2.08: d1d1ka_ - Chain 'B':
Compound: shiga-like toxin I subunit b
Species: Phage h30 [TaxId:12371]
Database cross-references and differences (RAF-indexed):
- Uniprot P08027
- engineered mutation (16)
- engineered mutation (33)
Domains in SCOPe 2.08: d1d1kb_ - Chain 'C':
Compound: shiga-like toxin I subunit b
Species: Phage h30 [TaxId:12371]
Database cross-references and differences (RAF-indexed):
- Uniprot P08027
- engineered mutation (16)
- engineered mutation (33)
Domains in SCOPe 2.08: d1d1kc_ - Chain 'D':
Compound: shiga-like toxin I subunit b
Species: Phage h30 [TaxId:12371]
Database cross-references and differences (RAF-indexed):
- Uniprot P08027
- engineered mutation (16)
- engineered mutation (33)
Domains in SCOPe 2.08: d1d1kd_ - Chain 'E':
Compound: shiga-like toxin I subunit b
Species: Phage h30 [TaxId:12371]
Database cross-references and differences (RAF-indexed):
- Uniprot P08027 (0-68)
- engineered mutation (16)
- engineered mutation (33)
Domains in SCOPe 2.08: d1d1ke_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1d1kA (A:)
tpdcvtgkveytkyndedtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
ggfsevifr
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1d1kB (B:)
tpdcvtgkveytkyndedtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
ggfsevifr
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1d1kC (C:)
tpdcvtgkveytkyndedtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
ggfsevifr
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1d1kD (D:)
tpdcvtgkveytkyndedtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
ggfsevifr
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>1d1kE (E:)
tpdcvtgkveytkyndedtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
ggfsevifr