PDB entry 1d1j

View 1d1j on RCSB PDB site
Description: crystal structure of human profilin II
Class: contractile protein
Keywords: acidic profilin isoform, actin-binding protein, poly-l-proline binding protein, contractile protein
Deposited on 1999-09-17, released 1999-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.216
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: profilin II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d1ja_
  • Chain 'B':
    Compound: profilin II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d1jb_
  • Chain 'C':
    Compound: profilin II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d1jc_
  • Chain 'D':
    Compound: profilin II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d1jd_
  • Heterogens: SO4, PG6, PG5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d1jA (A:)
    agwqsyvdnlmcdgccqeaaivgycdakyvwaataggvfqsitpieidmivgkdregfft
    ngltlgakkcsvirdslyvdgdctmdirtksqggeptynvavgragralvivmgkegvhg
    gtlnkkayelalylrrsdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d1jA (A:)
    agwqsyvdnlmcdgccqeaaivgycdakyvwaataggvfqsitpieidmivgkdregfft
    ngltlgakkcsvirdslyvdgdctmdirtksqggeptynvavgragralvivmgkegvhg
    gtlnkkayelalylrrsd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d1jB (B:)
    agwqsyvdnlmcdgccqeaaivgycdakyvwaataggvfqsitpieidmivgkdregfft
    ngltlgakkcsvirdslyvdgdctmdirtksqggeptynvavgragralvivmgkegvhg
    gtlnkkayelalylrrsdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d1jB (B:)
    gwqsyvdnlmcdgccqeaaivgycdakyvwaataggvfqsitpieidmivgkdregfftn
    gltlgakkcsvirdslyvdgdctmdirtksqggeptynvavgragralvivmgkegvhgg
    tlnkkayelalylrrs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1d1jC (C:)
    agwqsyvdnlmcdgccqeaaivgycdakyvwaataggvfqsitpieidmivgkdregfft
    ngltlgakkcsvirdslyvdgdctmdirtksqggeptynvavgragralvivmgkegvhg
    gtlnkkayelalylrrsdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d1jC (C:)
    agwqsyvdnlmcdgccqeaaivgycdakyvwaataggvfqsitpieidmivgkdregfft
    ngltlgakkcsvirdslyvdgdctmdirtksqggeptynvavgragralvivmgkegvhg
    gtlnkkayelalylrrs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1d1jD (D:)
    agwqsyvdnlmcdgccqeaaivgycdakyvwaataggvfqsitpieidmivgkdregfft
    ngltlgakkcsvirdslyvdgdctmdirtksqggeptynvavgragralvivmgkegvhg
    gtlnkkayelalylrrsdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d1jD (D:)
    agwqsyvdnlmcdgccqeaaivgycdakyvwaataggvfqsitpieidmivgkdregfft
    ngltlgakkcsvirdslyvdgdctmdirtksqggeptynvavgragralvivmgkegvhg
    gtlnkkayelalylrrsd