PDB entry 1d1i

View 1d1i on RCSB PDB site
Description: mutated shiga-like toxin b subunit (w34a) complexed with receptor gb3 analogue
Class: toxin
Keywords: toxin, receptor binding, protein-carbohydrate recognition, ob-fold
Deposited on 1999-09-17, released 2000-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-09-01, with a file datestamp of 2009-08-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.191
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: shiga toxin b-chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08027
      • engineered (33)
    Domains in SCOPe 2.07: d1d1ia_
  • Chain 'B':
    Compound: shiga toxin b-chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08027
      • engineered (33)
    Domains in SCOPe 2.07: d1d1ib_
  • Chain 'C':
    Compound: shiga toxin b-chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08027
      • engineered (33)
    Domains in SCOPe 2.07: d1d1ic_
  • Chain 'D':
    Compound: shiga toxin b-chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08027
      • engineered (33)
    Domains in SCOPe 2.07: d1d1id_
  • Chain 'E':
    Compound: shiga toxin b-chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08027 (0-68)
      • engineered (33)
    Domains in SCOPe 2.07: d1d1ie_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1iA (A:)
    tpdcvtgkveytkyndddtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1iB (B:)
    tpdcvtgkveytkyndddtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1iC (C:)
    tpdcvtgkveytkyndddtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1iD (D:)
    tpdcvtgkveytkyndddtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1iE (E:)
    tpdcvtgkveytkyndddtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
    ggfsevifr