PDB entry 1d1d

View 1d1d on RCSB PDB site
Description: nmr solution structure of the capsid protein from rous sarcoma virus
Class: Viral protein
Keywords: two independent domains helical bundles, virus/viral protein
Deposited on 1999-09-15, released 1999-12-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (capsid protein)
    Species: Rous sarcoma virus [TaxId:11886]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d1da1, d1d1da2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d1dA (A:)
    ghhhhhhhhhhssghiegrhnmpvviktegpawtplepklitrladtvrtkglrspitma
    evealmsspllphdvtnlmrvilgpapyalwmdawgvqlqtviaaatrdprhpangqgrg
    ertnldrlkgladgmvgnpqgqaallrpgelvaitasalqafrevarlaepagpwaditq
    gpsesfvdfanrlikavegsdlppsarapviidcfrqksqpdiqqliraapstlttpgei
    ikyvldrqkiapltdqgiaaam
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d1dA (A:)
    wtplepklitrladtvrtkglrspitmaevealmsspllphdvtnlmrvilgpapyalwm
    dawgvqlqtviaaatrdprhpangqgrgertnldrlkgladgmvgnpqgqaallrpgelv
    aitasalqafrevarlaepagpwaditqgpsesfvdfanrlikavegsdlppsarapvii
    dcfrqksqpdiqqliraapstlttpgeiikyvldrqkiap