PDB entry 1d1b

View 1d1b on RCSB PDB site
Description: dictyostelium myosin s1dc (motor domain fragment) complexed with o,p-dinitrophenyl aminopropyldiphosphate beryllium trifluoride.
Class: contractile protein
Keywords: myosin, motility, actin-binding, motor domain, nanologs
Deposited on 1999-09-15, released 2000-01-12
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.204
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin
    Species: Dictyostelium discoideum
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08799
      • see remark 999 (311)
    Domains in SCOP 1.75: d1d1ba1, d1d1ba2
  • Heterogens: MG, DAQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d1bA (A:)
    mnpihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsf
    tfktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysg
    lflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitge
    sgagktentkkviqylasvagrnqangsgvleqqilqanpileafgnakttrnnnssrfg
    kfieiqfnnagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlag
    pesfnylnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfe
    kgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrda
    lvkalygrlflwlvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcinytneklqq
    ffnhhmfkleqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatd
    ntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcf
    kdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnn
    kqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsq
    katdavlkhlnidpeqyrfgitkiffragqlarieearepn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d1bA (A:)
    npihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsft
    fktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysgl
    flvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitges
    gagktentkkviqylasvagrngvleqqilqanpileafgnakttrnnnssrfgkfieiq
    fnnagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlagpesfny
    lnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfekgageg
    avlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdalvkaly
    grlflwlvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcinytneklqqffnhhm
    fkleqeeyidfgldsqatidlidgrqppgilalldeqsvfpnatdntlitklhshfskkn
    akyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfkdssdnvvtklfndp
    niasrafitvaaqykeqlaslmatlettnphfvrciipnnkqlpakledkvvldqlrcng
    vlegiritrkgfpnriiyadfvkryylnvprdaedsqkatdavlkhlnidpeqyrfgitk
    iffragqlarieeare