PDB entry 1d0x

View 1d0x on RCSB PDB site
Description: dictyostelium myosin s1dc (motor domain fragment) complexed with m-nitrophenyl aminoethyldiphosphate beryllium trifluoride.
Class: contractile protein
Keywords: myosin, motility, actin-binding, motor domain, nanologs
Deposited on 1999-09-15, released 2000-01-12
The last revision prior to the SCOP 1.75 freeze date was dated 2000-12-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin s1dc motor domain
    Species: Dictyostelium discoideum
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08799
      • see remark 999 (311)
    Domains in SCOP 1.75: d1d0xa1, d1d0xa2
  • Heterogens: MG, MNQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d0xA (A:)
    mnpihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsf
    tfktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysg
    lflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitge
    sgagktentkkviqylasvagrnqangsgvleqqilqanpileafgnakttrnnnssrfg
    kfieiqfnnagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlag
    pesfnylnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfe
    kgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrda
    lvkalygrlflwlvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcinytneklqq
    ffnhhmfkleqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatd
    ntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcf
    kdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnn
    kqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsq
    katdavlkhlnidpeqyrfgitkiffragqlarieearepn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0xA (A:)
    npihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyecgeivsetsdsft
    fktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysgl
    flvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitges
    gagktentkkviqylasvagrngvleqqilqanpileafgnakttrnnnssrfgkfieiq
    fnnagfisgasiqsylleksrvvfqseternyhifyqllagataeekkalhlagpesfny
    lnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfekgageg
    avlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdalvkaly
    grlflwlvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcinytneklqqffnhhm
    fkleqeeylkekindsqatidlidgrqppgilalldeqsvfpnatdntlitklhshfskk
    nakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfkdssdnvvtklfnd
    pniasrafitvaaqykeqlaslmatlettnphfvrciipnnkqlpakledkvvldqlrcn
    gvlegiritrkgfpnriiyadfvkryyllapnvprdaedsqkatdavlkhlnidpeqyrf
    gitkiffragqlarieeare