PDB entry 1d0v

View 1d0v on RCSB PDB site
Description: crystal structure of nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (cobt) from salmonella typhimurium complexed with its reaction products determined to 1.9 a resolution
Class: transferase
Keywords: dinucleotide-binding motif, phosphoribosyltransferase, transferase
Deposited on 1999-09-14, released 1999-12-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05603
      • see remark 999 (157)
    Domains in SCOPe 2.08: d1d0va_
  • Heterogens: RBZ, NIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d0vA (A:)
    mqtlhallrdipapdaeamartqqhidgllkppgslgrletlavqlagmpglngtpqvge
    kavlvmcadhgvwdegvavspkivtaiqaanmtrgttgvcvlaaqagakvhvidvgidae
    pipgvvnmrvargcgniavgpamsrlqaealllevsryacdlaqrgvtlfgvgelgmant
    tpaaamvsvftgsdakevvgiganlppsridnkvdvvrraiainqpnprdgidvlskvgg
    fdlvgmtgvmlgaarcglpvlldgflsysaalaacqiapavrpylipshfsaekgarial
    ahlsmepylhmamrlgegsgaalampiveaacamfhnmgelaasnivlpegnanat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0vA (A:)
    lhallrdipapdaeamartqqhidgllkppgslgrletlavqlagmpglngtpqvgekav
    lvmcadhgvwdegvavspkivtaiqaanmtrgttgvcvlaaqagakvhvidvgidaepip
    gvvnmrvargcgniavgpamsrlqaealllevsryacdlaqrgvtlfgvgelgmanttpa
    aamvsvftgsdakevvgiganlppsridnkvdvvrraiainqpnprdgidvlskvggfdl
    vgmtgvmlgaarcglpvlldgflsysaalaacqiapavrpylipshfsaekgarialahl
    smepylhmamrlgegsgaalampiveaacamfhnmgelaasnivlp