PDB entry 1d0r

View 1d0r on RCSB PDB site
Description: solution structure of glucagon-like peptide-1-(7-36)-amide in trifluoroethanol/water
Class: hormone/growth factor
Keywords: synthetic hormone, hormone/growth factor complex
Deposited on 1999-09-14, released 2002-10-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucagon-like peptide-1-(7-36)-amide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1d0ra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d0rA (A:)
    haegtftsdvssylegqaakefiawlvkgr