PDB entry 1d0r

View 1d0r on RCSB PDB site
Description: solution structure of glucagon-like peptide-1-(7-36)-amide in trifluoroethanol/water
Deposited on 1999-09-14, released 2002-10-16
The last revision prior to the SCOP 1.71 freeze date was dated 2002-10-23, with a file datestamp of 2002-10-23.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1d0ra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d0rA (A:)
    haegtftsdvssylegqaakefiawlvkgr