PDB entry 1d0r

View 1d0r on RCSB PDB site
Description: solution structure of glucagon-like peptide-1-(7-36)-amide in trifluoroethanol/water
Class: hormone/growth factor
Keywords: synthetic hormone, hormone-growth factor complex
Deposited on 1999-09-14, released 2002-10-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: glucagon-like peptide-1-(7-36)-amide
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01275 (0-29)
  Domains in SCOPe 2.08: d1d0ra_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d0rA (A:)
  haegtftsdvssylegqaakefiawlvkgr