PDB entry 1d0q

View 1d0q on RCSB PDB site
Description: structure of the zinc-binding domain of bacillus stearothermophilus dna primase
Deposited on 1999-09-14, released 2000-03-29
The last revision prior to the SCOP 1.55 freeze date was dated 2001-01-10, with a file datestamp of 2001-01-10.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.244
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1d0qa_
  • Chain 'B':
    Domains in SCOP 1.55: d1d0qb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1d0qA (A:)
ghripeetieairrgvdivdvigeyvqlkrqgrnyfglcpfhgektpsfsvspekqifhc
fgcgaggnaftflmdiegipfveaakrlaakagvdlsvyeld

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1d0qB (B:)
ghripeetieairrgvdivdvigeyvqlkrqgrnyfglcpfhgektpsfsvspekqifhc
fgcgaggnaftflmdiegipfveaakrlaakagvdlsvyeld