PDB entry 1d0q

View 1d0q on RCSB PDB site
Description: structure of the zinc-binding domain of bacillus stearothermophilus DNA primase
Class: transferase
Keywords: DNA primase, zinc-binding motif, protein, transferase
Deposited on 1999-09-14, released 2000-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.204
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA primase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d0qa_
  • Chain 'B':
    Compound: DNA primase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d0qb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d0qA (A:)
    mghripeetieairrgvdivdvigeyvqlkrqgrnyfglcpfhgektpsfsvspekqifh
    cfgcgaggnaftflmdiegipfveaakrlaakagvdlsvyeld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0qA (A:)
    ghripeetieairrgvdivdvigeyvqlkrqgrnyfglcpfhgektpsfsvspekqifhc
    fgcgaggnaftflmdiegipfveaakrlaakagvdlsvyeld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d0qB (B:)
    mghripeetieairrgvdivdvigeyvqlkrqgrnyfglcpfhgektpsfsvspekqifh
    cfgcgaggnaftflmdiegipfveaakrlaakagvdlsvyeld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0qB (B:)
    ghripeetieairrgvdivdvigeyvqlkrqgrnyfglcpfhgektpsfsvspekqifhc
    fgcgaggnaftflmdiegipfveaakrlaakagvdlsvyeld