PDB entry 1d0n

View 1d0n on RCSB PDB site
Description: the crystal structure of calcium-free equine plasma gelsolin.
Class: contractile protein
Keywords: mixed alpha-beta structure, actin-binding protein, protein domain packing, contractile protein
Deposited on 1999-09-13, released 1999-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.205
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d0nA (A:)
    vehpeflkagkepglqiwrvekfdlvpvppnlygdfftgdayvilktvqlrngilqydlh
    ywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggva
    sgfkhvvpnevvvqrllqvkgrrvvratevpvswesfnngdcfildlgnniyqwcgsksn
    rferlkatqvskgirdnersgraqvsvfeegaepeamlqvlgpkptlpeatedtvkedaa
    nrklaklykvsngagpmvvslvadenpfaqgalrsedcfildhgkdgkifvwkgkqanme
    erkaalktasdfiskmdypkqtqvsvlpeggetplfrqffknwrdpdqteglglaylssh
    iahvervpfdaatlhtstamaaqhgmdddgtgqkqiwrvegsnkvpvdpatygqfyggds
    yiilynyrhgsrqgqiiynwqgaqstqdevaasailtaqldeelggtpvqsrvvqgkepa
    hlmslfggkpmivykggtsreggqtapastrlfqvrasssgatraveiipkagalnsnda
    fvlktpsaaylwvgagaseaektgaqellrvlraqpvqvaegsepdsfwealggkatyrt
    sprlkdkkmdahpprlfacsnkigrfvieevpgefmqedlatddvmlldtwdqvfvwvgk
    dsqdeektealtsakryidtdpahrdrrtpitvvkqgfeppsfvgwflgwddsywsvdpl
    dralaelaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d0nB (B:)
    vehpeflkagkepglqiwrvekfdlvpvppnlygdfftgdayvilktvqlrngilqydlh
    ywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggva
    sgfkhvvpnevvvqrllqvkgrrvvratevpvswesfnngdcfildlgnniyqwcgsksn
    rferlkatqvskgirdnersgraqvsvfeegaepeamlqvlgpkptlpeatedtvkedaa
    nrklaklykvsngagpmvvslvadenpfaqgalrsedcfildhgkdgkifvwkgkqanme
    erkaalktasdfiskmdypkqtqvsvlpeggetplfrqffknwrdpdqteglglaylssh
    iahvervpfdaatlhtstamaaqhgmdddgtgqkqiwrvegsnkvpvdpatygqfyggds
    yiilynyrhgsrqgqiiynwqgaqstqdevaasailtaqldeelggtpvqsrvvqgkepa
    hlmslfggkpmivykggtsreggqtapastrlfqvrasssgatraveiipkagalnsnda
    fvlktpsaaylwvgagaseaektgaqellrvlraqpvqvaegsepdsfwealggkatyrt
    sprlkdkkmdahpprlfacsnkigrfvieevpgefmqedlatddvmlldtwdqvfvwvgk
    dsqdeektealtsakryidtdpahrdrrtpitvvkqgfeppsfvgwflgwddsywsvdpl
    dralaelaa