PDB entry 1d0l

View 1d0l on RCSB PDB site
Description: the escherichia coli lytic transglycosylase slt35 in complex with bulgecin a
Class: transferase
Keywords: alpha-helical protein with a five stranded anti-parallel beta-sheet, glycosyl transferase, ef-hand
Deposited on 1999-09-12, released 2000-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.168
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 35kd soluble lytic transglycosylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41052 (0-321)
      • engineered (0-1)
    Domains in SCOPe 2.07: d1d0la_
  • Heterogens: CA, BLG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d0lA (A:)
    mvepqhnvmqmggdfannpnaqqfidkmvnkhgfdrqqlqeilsqakrldsvlrlmdnqa
    pttsvkppsgpngawlryrkkfitpdnvqngvvfwnqyedalnrawqvygvppeiivgii
    gvetrwgrvmgktrildalatlsfnyprraeyfsgeletfllmardeqddplnlkgsfag
    amgygqfmpssykqyavdfsgdghinlwdpvdaigsvanyfkahgwvkgdqvavmangqa
    pglpngfktkysisqlaaagltpqqplgnhqqasllrldvgtgyqywyglpnfytitryn
    hsthyamavwqlgqavalarvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0lA (A:)
    mvepqhnvmqmggdfannpnaqqfidkmvnkhgfdrqqlqeilsqakrldsvlrlmdnqa
    pgpngawlryrkkfitpdnvqngvvfwnqyedalnrawqvygvppeiivgiigvetrwgr
    vmgktrildalatlsfnyprraeyfsgeletfllmardeqddplnlkgsfagamgygqfm
    pssykqyavdfsgdghinlwdpvdaigsvanyfkahgwvkgdqvavmangqapglpngfk
    tkysisqlaaagltpqqplgnhqqasllrldvgtgyqywyglpnfytitrynhsthyama
    vwqlgqavalarvq