PDB entry 1d0h

View 1d0h on RCSB PDB site
Description: the hc fragment of tetanus toxin complexed with n-acetyl-galactosamine
Class: toxin
Keywords: beta trefoil, jelly-roll, toxin
Deposited on 1999-09-10, released 2000-03-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.205
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (tetanus toxin hc)
    Species: Clostridium tetani [TaxId:1513]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1d0ha1, d1d0ha2
  • Heterogens: A2G, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d0hA (A:)
    mghghhhhhhhhhhssghiegrhmldneedidvilkkstilnldinndiisdisgfnssv
    itypdaqlvpgingkaihlvnnessevivhkamdieyndmfnnftvsfwlrvpkvsashl
    eqygtneysiissmkkhslsigsgwsvslkgnnliwtlkdsagevrqitfrdlpdkfnay
    lankwvfititndrlssanlyingvlmgsaeitglgairednnitlkldrcnnnnqyvsi
    dkfrifckalnpkeieklytsylsitflrdfwgnplrydteyylipvassskdvqlknit
    dymyltnapsytngklniyyrrlynglkfiikrytpnneidsfvksgdfiklyvsynnne
    hivgypkdgnafnnldrilrvgynapgiplykkmeavklrdlktysvqlklyddknaslg
    lvgthngqigndpnrdiliasnwyfnhlkdkilgcdwyfvptdegwtnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0hA (A:)
    edidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaihlvnnessevi
    vhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhslsigsgwsvs
    lkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssanlyingvlmg
    saeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeieklytsylsitfl
    rdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrlynglk
    fiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgynapgi
    plykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwyfnhl
    kdkilgcdwyfvptdegwtnd