PDB entry 1d0e

View 1d0e on RCSB PDB site
Description: crystal structures of the n-terminal fragment from moloney murine leukemia virus reverse transcriptase complexed with nucleic acid: functional implications for template-primer binding to the fingers domain
Class: transferase/DNA
Keywords: protein-DNA complex, polymerase, reverse transcriptase, moloney murine leukemia virus, transferase-DNA complex
Deposited on 1999-09-09, released 2000-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.215
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: reverse transcriptase
    Species: Murine leukemia virus [TaxId:11801]
    Gene: MMLV-RT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d0ea_
  • Chain 'B':
    Compound: reverse transcriptase
    Species: Murine leukemia virus [TaxId:11801]
    Gene: MMLV-RT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d0eb_
  • Chain 'E':
    Compound: 5'-d(*tp*tp*tp*cp*ap*tp*gp*cp*ap*tp*g)-3'
  • Chain 'F':
    Compound: 5'-d(*tp*tp*tp*cp*ap*tp*gp*cp*ap*tp*g)-3'

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d0eA (A:)
    gshmtwlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiq
    rlldqgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsgl
    ppshqwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlf
    dealhrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakka
    qicqkqvkylgyllkegqr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d0eB (B:)
    gshmtwlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiq
    rlldqgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsgl
    ppshqwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlf
    dealhrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakka
    qicqkqvkylgyllkegqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0eB (B:)
    hmtwlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrl
    ldqgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglpp
    shqwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfde
    alhrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqi
    cqkqvkylgyllkegqr
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.