PDB entry 1d0b

View 1d0b on RCSB PDB site
Description: internalin b leucine rich repeat domain
Class: cell adhesion
Keywords: leucine rich repeat, calcium binding, cell adhesion
Deposited on 1999-09-09, released 2000-01-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.207
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: internalin b
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d0ba_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d0bA (A:)
    etitvstpikqifpddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq
    ylpnvtklflngnkltdikpltnlknlgwlfldenkikdlsslkdlkklkslslehngis
    dinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnlyl
    sknhisdlralaglknldvlelfsqeclnkpin
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d0bA (A:)
    etitvstpikqifpddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq
    ylpnvtklflngnkltdikpltnlknlgwlfldenkikdlsslkdlkklkslslehngis
    dinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnlyl
    sknhisdlralaglknldvlelfsqec