PDB entry 1d0a

View 1d0a on RCSB PDB site
Description: structure of tnf receptor associated factor 2 (traf2) in complex with a human ox40 peptide
Class: apoptosis
Keywords: b-sandwich, protein-peptide complex, apoptosis
Deposited on 1999-09-09, released 2000-03-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: tumor necrosis factor receptor associated protein 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12933 (0-167)
    • conflict (31)
  Domains in SCOPe 2.06: d1d0aa1, d1d0aa2
• Chain 'B':
  Compound: tumor necrosis factor receptor associated protein 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12933 (0-167)
    • conflict (31)
  Domains in SCOPe 2.06: d1d0ab1, d1d0ab2
• Chain 'C':
  Compound: tumor necrosis factor receptor associated protein 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12933 (0-167)
    • conflict (31)
  Domains in SCOPe 2.06: d1d0ac1, d1d0ac2
• Chain 'D':
  Compound: tumor necrosis factor receptor associated protein 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12933 (0-167)
    • conflict (31)
  Domains in SCOPe 2.06: d1d0ad1, d1d0ad2
• Chain 'E':
  Compound: tumor necrosis factor receptor associated protein 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12933 (0-167)
    • conflict (31)
  Domains in SCOPe 2.06: d1d0ae1, d1d0ae2
• Chain 'F':
  Compound: tumor necrosis factor receptor associated protein 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12933 (0-167)
    • conflict (31)
  Domains in SCOPe 2.06: d1d0af1, d1d0af2
• Chain 'G':
  Compound: ox40l receptor peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43489 (0-4)
• Chain 'H':
  Compound: ox40l receptor peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43489 (0-4)
• Chain 'I':
  Compound: ox40l receptor peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43489 (0-4)
• Chain 'J':
  Compound: ox40l receptor peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43489 (0-4)
• Chain 'K':
  Compound: ox40l receptor peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43489 (0-4)
• Chain 'L':
  Compound: ox40l receptor peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43489 (0-4)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d0aA (A:)
  amadleqkvlemeastydgvfiwkisdfprkrqeavagripaifspafytsrygykmclr
  iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
  ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d0aB (B:)
  amadleqkvlemeastydgvfiwkisdfprkrqeavagripaifspafytsrygykmclr
  iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
  ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d0aC (C:)
  amadleqkvlemeastydgvfiwkisdfprkrqeavagripaifspafytsrygykmclr
  iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
  ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d0aD (D:)
  amadleqkvlemeastydgvfiwkisdfprkrqeavagripaifspafytsrygykmclr
  iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
  ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d0aE (E:)
  amadleqkvlemeastydgvfiwkisdfprkrqeavagripaifspafytsrygykmclr
  iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
  ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d0aF (F:)
  amadleqkvlemeastydgvfiwkisdfprkrqeavagripaifspafytsrygykmclr
  iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
  ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
  

  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.