PDB entry 1d0a

View 1d0a on RCSB PDB site
Description: structure of tnf receptor associated factor 2 (traf2) in complex with a human ox40 peptide
Class: apoptosis
Keywords: b-sandwich, protein-peptide complex, apoptosis
Deposited on 1999-09-09, released 2000-03-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12933 (0-167)
      • conflict (31)
    Domains in SCOPe 2.06: d1d0aa1, d1d0aa2
  • Chain 'B':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12933 (0-167)
      • conflict (31)
    Domains in SCOPe 2.06: d1d0ab1, d1d0ab2
  • Chain 'C':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12933 (0-167)
      • conflict (31)
    Domains in SCOPe 2.06: d1d0ac1, d1d0ac2
  • Chain 'D':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12933 (0-167)
      • conflict (31)
    Domains in SCOPe 2.06: d1d0ad1, d1d0ad2
  • Chain 'E':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12933 (0-167)
      • conflict (31)
    Domains in SCOPe 2.06: d1d0ae1, d1d0ae2
  • Chain 'F':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12933 (0-167)
      • conflict (31)
    Domains in SCOPe 2.06: d1d0af1, d1d0af2
  • Chain 'G':
    Compound: ox40l receptor peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: ox40l receptor peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: ox40l receptor peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: ox40l receptor peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: ox40l receptor peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: ox40l receptor peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d0aA (A:)
    amadleqkvlemeastydgvfiwkisdfprkrqeavagripaifspafytsrygykmclr
    iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
    ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d0aB (B:)
    amadleqkvlemeastydgvfiwkisdfprkrqeavagripaifspafytsrygykmclr
    iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
    ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d0aC (C:)
    amadleqkvlemeastydgvfiwkisdfprkrqeavagripaifspafytsrygykmclr
    iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
    ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d0aD (D:)
    amadleqkvlemeastydgvfiwkisdfprkrqeavagripaifspafytsrygykmclr
    iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
    ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d0aE (E:)
    amadleqkvlemeastydgvfiwkisdfprkrqeavagripaifspafytsrygykmclr
    iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
    ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d0aF (F:)
    amadleqkvlemeastydgvfiwkisdfprkrqeavagripaifspafytsrygykmclr
    iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
    ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.