PDB entry 1d07

View 1d07 on RCSB PDB site
Description: Hydrolytic haloalkane dehalogenase linb from sphingomonas paucimobilis UT26 with 1,3-propanediol, a product of debromidation of dibrompropane, at 2.0A resolution
Class: hydrolase
Keywords: dehalogenase, lindane, biodegradation, alpha/beta-hydrolase, hydrolase
Deposited on 1999-09-09, released 2000-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: haloalkane dehalogenase
    Species: SPHINGOMONAS PAUCIMOBILIS [TaxId:13689]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d07a_
  • Heterogens: BR, PDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d07A (A:)
    mslgakpfgekkfieikgrrmayidegtgdpilfqhgnptssylwrnimphcaglgrlia
    cdligmgdsdkldpsgperyayaehrdyldalwealdlgdrvvlvvhdwgsalgfdwarr
    hrervqgiaymeaiampiewadfpeqdrdlfqafrsqageelvlqdnvfveqvlpglilr
    plseaemaayrepflaagearrptlswprqipiagtpadvvaiardyagwlsespipklf
    inaepgalttgrmrdfcrtwpnqteitvagahfiqedspdeigaaiaafvrrlrpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d07A (A:)
    gakpfgekkfieikgrrmayidegtgdpilfqhgnptssylwrnimphcaglgrliacdl
    igmgdsdkldpsgperyayaehrdyldalwealdlgdrvvlvvhdwgsalgfdwarrhre
    rvqgiaymeaiampiewadfpeqdrdlfqafrsqageelvlqdnvfveqvlpglilrpls
    eaemaayrepflaagearrptlswprqipiagtpadvvaiardyagwlsespipklfina
    epgalttgrmrdfcrtwpnqteitvagahfiqedspdeigaaiaafvrrlrpa