PDB entry 1d06

View 1d06 on RCSB PDB site
Description: structural basis of dimerization and sensory mechanisms of oxygen- sensing domain of rhizobium meliloti fixl determined at 1.4a resolution
Deposited on 1999-09-09, released 2000-03-15
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-15, with a file datestamp of 2000-03-15.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.224
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1d06a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d06A (A:)
    gshmletedvvrardahlrsildtvpdatvvsatdgtivsfnaaavrqfgyaeeevigqn
    lrilmpepyrhehdgylqrymatgekriigidrvvsgqrkdgstfpmklavgemrsgger
    fftgfirdlt