PDB entry 1d06

View 1d06 on RCSB PDB site
Description: structural basis of dimerization and sensory mechanisms of oxygen-sensing domain of rhizobium meliloti fixl determined at 1.4a resolution
Class: signaling protein
Keywords: oxygen sensor, histidine kinase, pas, high-resolution, two-component system, signaling protein
Deposited on 1999-09-09, released 2000-03-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: nitrogen fixation regulatory protein fixL
  Species: Sinorhizobium meliloti [TaxId:382]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10955 (0-129)
    • engineered (0-5)
  Domains in SCOPe 2.08: d1d06a_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d06A (A:)
  gshmletedvvrardahlrsildtvpdatvvsatdgtivsfnaaavrqfgyaeeevigqn
  lrilmpepyrhehdgylqrymatgekriigidrvvsgqrkdgstfpmklavgemrsgger
  fftgfirdlt