PDB entry 1d04

View 1d04 on RCSB PDB site
Description: comparisons of wild type and mutant flavodoxins from anacystis nidulans. structural determinants of the redox potentials.
Class: electron transport
Keywords: flavodoxin, fmn binding, redox potential, electron transport
Deposited on 1999-09-08, released 1999-12-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.168
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d04a_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d04A (A:)
    akiglfygtqtgvtqtiaesiqqefggesivdlndianadasdlnaydyliigcptwnvg
    elqsdwegiyddldsvnfqgkkvayfgagdqvgysdnfqdamgileekisslgsqtvgyw
    piegydfneskavrnnqfvglaidednqpdltknriktwvsqlksefgl