PDB entry 1d02

View 1d02 on RCSB PDB site
Description: crystal structure of muni restriction endonuclease in complex with cognate DNA
Class: hydrolase/DNA
Keywords: alpha/beta protein, protein-DNA complex, distorted double helix, hydrolase-DNA complex
Deposited on 1999-09-08, released 2000-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.18
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: type II restriction enzyme muni
    Species: Mycoplasma [TaxId:2093]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43642 (Start-201)
      • mutation (82)
    Domains in SCOPe 2.07: d1d02a_
  • Chain 'B':
    Compound: type II restriction enzyme muni
    Species: Mycoplasma [TaxId:2093]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43642 (Start-201)
      • mutation (82)
    Domains in SCOPe 2.07: d1d02b_
  • Chain 'C':
    Compound: DNA (5'-d(*gp*cp*cp*ap*ap*tp*tp*gp*gp*c)-3')
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: DNA (5'-d(*gp*cp*cp*ap*ap*tp*tp*gp*gp*c)-3')
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d02A (A:)
    mgkselsgrlnwqalaglkasgaeqnlynvfnavfegtkyvlyekpkhlknlyaqvvlpd
    dvikeifnplidlsttqwgvspafaientethkilfgeikrqdgwvegkdpsagrgnahe
    rscklftpgllkayrtiggindeeilpfwvvfegditrdpkrvreitfwydhyqdnyfmw
    rpnesgeklvqhfneklkkyld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d02A (A:)
    lsgrlnwqalaglkasgaeqnlynvfnavfegtkyvlyekpkhlknlyaqvvlpddvike
    ifnplidlsttqwgvspafaientethkilfgeikrqdgwvegkdpsagrgnahersckl
    ftpgllkayrtiggindeeilpfwvvfegditrdpkrvreitfwydhyqdnyfmwrpnes
    geklvqhfneklkkyld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d02B (B:)
    mgkselsgrlnwqalaglkasgaeqnlynvfnavfegtkyvlyekpkhlknlyaqvvlpd
    dvikeifnplidlsttqwgvspafaientethkilfgeikrqdgwvegkdpsagrgnahe
    rscklftpgllkayrtiggindeeilpfwvvfegditrdpkrvreitfwydhyqdnyfmw
    rpnesgeklvqhfneklkkyld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d02B (B:)
    kselsgrlnwqalaglkasgaeqnlynvfnavfegtkyvlyekpkhlknlyaqvvlpddv
    ikeifnplidlsttqwgvspafaientethkilfgeikrqdgwvegkdpsagrgnahers
    cklftpgllkayrtiggindeeilpfwvvfegditrdpkrvreitfwydhyqdnyfmwrp
    nesgeklvqhfneklkkyld
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.