PDB entry 1d00

View 1d00 on RCSB PDB site
Description: structure of tnf receptor associated factor 2 in complex with a 5-residue cd40 peptide
Class: apoptosis
Keywords: b-sandwich, protein-peptide complex, apoptosis
Deposited on 1999-09-07, released 2000-03-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.219
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB S56163 (0-167)
      • conflict (28)
      • conflict (31)
    Domains in SCOPe 2.06: d1d00a1, d1d00a2
  • Chain 'B':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB S56163 (0-167)
      • conflict (28)
      • conflict (31)
    Domains in SCOPe 2.06: d1d00b1, d1d00b2
  • Chain 'C':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB S56163 (0-167)
      • conflict (28)
      • conflict (31)
    Domains in SCOPe 2.06: d1d00c1, d1d00c2
  • Chain 'D':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB S56163 (0-167)
      • conflict (28)
      • conflict (31)
    Domains in SCOPe 2.06: d1d00d1, d1d00d2
  • Chain 'E':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB S56163 (0-167)
      • conflict (28)
      • conflict (31)
    Domains in SCOPe 2.06: d1d00e1, d1d00e2
  • Chain 'F':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB S56163 (0-167)
      • conflict (28)
      • conflict (31)
    Domains in SCOPe 2.06: d1d00f1, d1d00f2
  • Chain 'G':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB S56163 (0-167)
      • conflict (28)
      • conflict (31)
    Domains in SCOPe 2.06: d1d00g1, d1d00g2
  • Chain 'H':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB S56163 (0-167)
      • conflict (28)
      • conflict (31)
    Domains in SCOPe 2.06: d1d00h1, d1d00h2
  • Chain 'I':
    Compound: b-cell surface antigen cd40
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: b-cell surface antigen cd40
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: b-cell surface antigen cd40
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: b-cell surface antigen cd40
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: b-cell surface antigen cd40
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: b-cell surface antigen cd40
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: b-cell surface antigen cd40
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: b-cell surface antigen cd40
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d00A (A:)
    amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
    iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
    ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d00B (B:)
    amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
    iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
    ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d00C (C:)
    amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
    iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
    ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d00D (D:)
    amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
    iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
    ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d00E (E:)
    amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
    iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
    ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d00F (F:)
    amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
    iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
    ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d00G (G:)
    amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
    iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
    ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d00H (H:)
    amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
    iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
    ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.