PDB entry 1d00
View 1d00 on RCSB PDB site
Description: structure of tnf receptor associated factor 2 in complex with a 5-residue cd40 peptide
Class: apoptosis
Keywords: b-sandwich, protein-peptide complex, apoptosis
Deposited on
1999-09-07, released
2000-03-29
The last revision prior to the SCOPe 2.08 freeze date was dated
2018-01-31, with a file datestamp of
2018-01-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: tumor necrosis factor receptor associated protein 2
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- GB S56163 (0-167)
- conflict (28)
- conflict (31)
Domains in SCOPe 2.08: d1d00a1, d1d00a2 - Chain 'B':
Compound: tumor necrosis factor receptor associated protein 2
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- GB S56163 (0-167)
- conflict (28)
- conflict (31)
Domains in SCOPe 2.08: d1d00b1, d1d00b2 - Chain 'C':
Compound: tumor necrosis factor receptor associated protein 2
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- GB S56163 (0-167)
- conflict (28)
- conflict (31)
Domains in SCOPe 2.08: d1d00c1, d1d00c2 - Chain 'D':
Compound: tumor necrosis factor receptor associated protein 2
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- GB S56163 (0-167)
- conflict (28)
- conflict (31)
Domains in SCOPe 2.08: d1d00d1, d1d00d2 - Chain 'E':
Compound: tumor necrosis factor receptor associated protein 2
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- GB S56163 (0-167)
- conflict (28)
- conflict (31)
Domains in SCOPe 2.08: d1d00e1, d1d00e2 - Chain 'F':
Compound: tumor necrosis factor receptor associated protein 2
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- GB S56163 (0-167)
- conflict (28)
- conflict (31)
Domains in SCOPe 2.08: d1d00f1, d1d00f2 - Chain 'G':
Compound: tumor necrosis factor receptor associated protein 2
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- GB S56163 (0-167)
- conflict (28)
- conflict (31)
Domains in SCOPe 2.08: d1d00g1, d1d00g2 - Chain 'H':
Compound: tumor necrosis factor receptor associated protein 2
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- GB S56163 (0-167)
- conflict (28)
- conflict (31)
Domains in SCOPe 2.08: d1d00h1, d1d00h2 - Chain 'I':
Compound: b-cell surface antigen cd40
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'J':
Compound: b-cell surface antigen cd40
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'K':
Compound: b-cell surface antigen cd40
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'L':
Compound: b-cell surface antigen cd40
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'M':
Compound: b-cell surface antigen cd40
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'N':
Compound: b-cell surface antigen cd40
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'O':
Compound: b-cell surface antigen cd40
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'P':
Compound: b-cell surface antigen cd40
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1d00A (A:)
amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1d00B (B:)
amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1d00C (C:)
amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1d00D (D:)
amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>1d00E (E:)
amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
- Chain 'F':
Sequence; same for both SEQRES and ATOM records: (download)
>1d00F (F:)
amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
- Chain 'G':
Sequence; same for both SEQRES and ATOM records: (download)
>1d00G (G:)
amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>1d00H (H:)
amadleqkvlemeastydgvfiwkisdfarkrqeavagripaifspafytsrygykmclr
iylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvts
ssfqrpvndmniasgcplfcpvskmeaknsyvrddaifikaivdltgl
- Chain 'I':
No sequence available.
- Chain 'J':
No sequence available.
- Chain 'K':
No sequence available.
- Chain 'L':
No sequence available.
- Chain 'M':
No sequence available.
- Chain 'N':
No sequence available.
- Chain 'O':
No sequence available.
- Chain 'P':
No sequence available.