PDB entry 1czz

View 1czz on RCSB PDB site
Description: structure of tnf receptor associated factor 2 in complex with a 17-residue cd40 peptide
Class: apoptosis
Keywords: b-sandwich, protein-peptide complex, apoptosis
Deposited on 1999-09-07, released 2000-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12933 (0-186)
      • conflict (50)
    Domains in SCOPe 2.07: d1czza1, d1czza2
  • Chain 'B':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12933 (0-186)
      • conflict (50)
    Domains in SCOPe 2.07: d1czzb1, d1czzb2
  • Chain 'C':
    Compound: tumor necrosis factor receptor associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12933 (0-186)
      • conflict (50)
    Domains in SCOPe 2.07: d1czzc1, d1czzc2
  • Chain 'D':
    Compound: cd 40 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: cd 40 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czzA (A:)
    ealsskvqqlersiglkdlamadleqkvlemeastydgvfiwkisdfprkrqeavagrip
    aifspafytsrygykmclriylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlml
    ldqnnrehvidafrpdvtsssfqrpvndmniasgcplfcpvskmeaknsyvrddaifika
    ivdltgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czzB (B:)
    ealsskvqqlersiglkdlamadleqkvlemeastydgvfiwkisdfprkrqeavagrip
    aifspafytsrygykmclriylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlml
    ldqnnrehvidafrpdvtsssfqrpvndmniasgcplfcpvskmeaknsyvrddaifika
    ivdltgl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czzC (C:)
    ealsskvqqlersiglkdlamadleqkvlemeastydgvfiwkisdfprkrqeavagrip
    aifspafytsrygykmclriylngdgtgrgthlslffvvmkgpndallrwpfnqkvtlml
    ldqnnrehvidafrpdvtsssfqrpvndmniasgcplfcpvskmeaknsyvrddaifika
    ivdltgl
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.