PDB entry 1czu

View 1czu on RCSB PDB site
Description: refined structures of oxidized flavodoxin from anacystis nidulans
Deposited on 1999-09-07, released 1999-12-29
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.147
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1czua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czuA (A:)
    akiglfygtqtgvtqtiaesiqqefggesivdlndianadasdlnaydyliigcptwnvg
    elqsdwegiyddldsvnfqgkkvayfgagdqvgysdnfqdamgileekisslgsqtvgyw
    piegydfneskavrnnqfvglaidednqpdltknriktwvsqlksefgl