PDB entry 1czt

View 1czt on RCSB PDB site
Description: crystal structure of the c2 domain of human coagulation factor v
Class: blood clotting
Keywords: coagulation, membrane-binding, discoidin family, calcium-independent, blood clotting
Deposited on 1999-09-07, released 1999-11-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.201
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (coagulation factor v)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1czta_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cztA (A:)
    gcstplgmengkienkqitassfkkswwgdywepfrarlnaqgrvnawqakannnkqwle
    idllkikkitaiitqgckslssemyvksytihyseqgvewkpyrlkssmvdkifegntnt
    kghvknffnppiisrfirvipktwnqsitlrlelfgcdiy