PDB entry 1czs

View 1czs on RCSB PDB site
Description: crystal structure of the c2 domain of human coagulation factor v: complex with phenylmercury
Class: blood clotting
Keywords: coagulation, membrane-binding, discoidin family, calcium-independent, blood clotting
Deposited on 1999-09-07, released 1999-11-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (coagulation factor v)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12259 (0-159)
  Domains in SCOPe 2.07: d1czsa_
• Heterogens: PHG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1czsA (A:)
  gcstplgmengkienkqitassfkkswwgdywepfrarlnaqgrvnawqakannnkqwle
  idllkikkitaiitqgckslssemyvksytihyseqgvewkpyrlkssmvdkifegntnt
  kghvknffnppiisrfirvipktwnqsitlrlelfgcdiy