PDB entry 1czq

View 1czq on RCSB PDB site
Description: crystal structure of the d10-p1/iqn17 complex: a d-peptide inhibitor of hiv-1 entry bound to the gp41 coiled-coil pocket.
Class: Viral protein/inhibitor
Keywords: ENVELOPE GLYCOPROTEIN, Viral protein-inhibitor COMPLEX
Deposited on 1999-09-06, released 1999-10-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.214
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: fusion protein between the hydrophobic pocket of hiv gp41 and gcn4-piqi
  Species: , [TaxId:4932,12721]
  Database cross-references and differences (RAF-indexed):
  • GB U36871 (28-44)
  Domains in SCOPe 2.08: d1czqa_
• Chain 'D':
  Compound: d-peptide inhibitor
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1CZQ (Start-15)
• Heterogens: CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1czqA (A:)
  rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril
  

  
  
• Chain 'D':
  No sequence available.