PDB entry 1czp
View 1czp on RCSB PDB site
Description: anabaena pcc7119 [2fe-2s] ferredoxin in the reduced and oxixized state at 1.17 a
Class: electron transport
Keywords: [2fe-2s] protein, crystal reduced with dithionite, electron transport
Deposited on
1999-09-06, released
2000-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: 0.143
AEROSPACI score: 0.87
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ferredoxin I
Species: NOSTOC SP. [TaxId:1168]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1czpa_ - Chain 'B':
Compound: ferredoxin I
Species: NOSTOC SP. [TaxId:1168]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1czpb_ - Heterogens: FES, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1czpA (A:)
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
sdqsfldddqieagyvltcvayptsdvviqthkeedly
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1czpB (B:)
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
sdqsfldddqieagyvltcvayptsdvviqthkeedly