PDB entry 1czp

View 1czp on RCSB PDB site
Description: anabaena pcc7119 [2fe-2s] ferredoxin in the reduced and oxixized state at 1.17 a
Deposited on 1999-09-06, released 2000-01-14
The last revision prior to the SCOP 1.63 freeze date was dated 2000-01-14, with a file datestamp of 2000-01-13.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: 0.143
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1czpa_
  • Chain 'B':
    Domains in SCOP 1.63: d1czpb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1czpA (A:)
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
sdqsfldddqieagyvltcvayptsdvviqthkeedly

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1czpB (B:)
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
sdqsfldddqieagyvltcvayptsdvviqthkeedly