PDB entry 1czl

View 1czl on RCSB PDB site
Description: comparisons of wild type and mutant flavodoxins from anacystis nidulans. structural determinants of the redox potentials.
Deposited on 1999-09-03, released 1999-12-29
The last revision prior to the SCOP 1.59 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.165
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.59: d1czla_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1czlA (A:)
  akiglfygtqtgvtqtiaesiqqefggesivdlndianadasdlnaydyliigcptwnvg
  elqsdwegiyddldsvnfqgkkvayfgagdqvgysdnfqdamgileekisslgsqtvgyw
  piegydfneskavrnnqfvglaidednqpdltknriktwvsqlksefgl