PDB entry 1czk

View 1czk on RCSB PDB site
Description: comparisons of wild type and mutant flavodoxins from anacystis nidulans. structural determinants of the redox potentials.
Deposited on 1999-09-03, released 1999-12-29
The last revision prior to the SCOP 1.57 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.157
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1czka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czkA (A:)
    akiglfygtqtgvtqtiaesiqqefggesivdlndianadasdlnaydyliigcptwnvg
    elqsdwegiyddldsvnfqgkkvayfgagdqvgysdnfqnamgileekisslgsqtvgyw
    piegydfneskavrnnqfvglaidednqpdltknriktwvsqlksefgl