SCOP: Structural Classification of Proteins and ASTRAL

Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)

PDB entry 1czk

View 1czk on RCSB PDB site
Description: comparisons of wild type and mutant flavodoxins from anacystis nidulans. structural determinants of the redox potentials.
Class: electron transport
Keywords: flavodoxin, redox potential, fmn binding, electron transport
Deposited on 1999-09-03, released 1999-12-29
The last revision prior to the SCOP 1.75B freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.157
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: flavodoxin
Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
Domains in SCOP 1.75B: d1czka_
Heterogens: FMN, HOH

PDB Chain Sequences:

Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)

>1czkA (A:)
akiglfygtqtgvtqtiaesiqqefggesivdlndianadasdlnaydyliigcptwnvg
elqsdwegiyddldsvnfqgkkvayfgagdqvgysdnfqnamgileekisslgsqtvgyw
piegydfneskavrnnqfvglaidednqpdltknriktwvsqlksefgl