PDB entry 1czi

View 1czi on RCSB PDB site
Description: chymosin complex with the inhibitor cp-113972
Class: complex (aspartyl protease/inhibitor)
Keywords: hydrolase (acid proteinase), inhibitor complex, complex (aspartyl protease/inhibitor)
Deposited on 1997-01-15, released 1997-04-01
The last revision prior to the SCOP 1.73 freeze date was dated 1997-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.1954
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: chymosin
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1czie_
  • Chain 'P':
    Compound: cp-113972 (norstatine-s-methyl cysteine-iodo-phenylalanine-proline)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cziE (E:)
    gevasvpltnyldsqyfgkiylgtppqeftvlfdtgssdfwvpsiycksnacknhqrfdp
    rksstfqnlgkplsihygtgsmqgilgydtvtvsnivdiqqtvglstqepgdvftyaefd
    gilgmaypslaseysipvfdnmmnrhlvaqdlfsvymdrngqesmltlgaidpsyytgsl
    hwvpvtvqqywqftvdsvtisgvvvaceggcqaildtgtsklvgpssdilniqqaigatq
    nqygefdidcdnlsymptvvfeingkmypltpsaytsqdqgfctsgfqsenhsqkwilgd
    vfireyysvfdrannlvglakai
    

  • Chain 'P':
    No sequence available.